PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29889.m003285
Common NameRCOM_1000430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 576aa    MW: 64817.8 Da    PI: 5.1494
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29889.m003285genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS277.83.2e-852095742374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     elLl  Ae v +++ e+a+ lL++   l+s++g++++R+++yf +AL++r+ r++ +   + ++ + +e  ++ + ++l   ++  P+ +++h++
  29889.m003285 209 AELLLLSAEKVGNQQYERASILLNQCDRLSSSTGNAVERVVHYFCKALRERIDRETGKSLGKQHCFNIDEAIMAPSSTILA-SYQEVPFSQVAHFA 303
                    5789999***********************************************333333333444443333333333333.45667********* PP

           GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                      qaI+e v  ++r+H+iD++i  G+QW  L+qaL s    +   l+iT+vg    +sk+ ++ tg+rL++fAe++ +pf fn+++++++ dl+ +
  29889.m003285 304 GIQAIVENVTDAKRIHVIDLGIRVGVQWTGLMQALVSDFdCNLELLKITAVGT---TSKHLIKDTGKRLTSFAESISLPFAFNIVMVSDMLDLTED 396
                    ************************************87647788*********...6899************************************ PP

           GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                    +++++++ +++V + + l +l     sl+++ ++v+k+++ l+P + vv+e e + +s+sF++rf+eal y+sa fd+le+ + +++++r+ +E  
  29889.m003285 397 QFELDSDQTVVVYCEYLLRSLI----SLPDRLNSVMKVIRILNPSITVVTEPEYNSTSSSFVNRFIEALFYFSAYFDCLESCM-KDNSNRMILESL 487
                    ****************888887....77777788**********************************************996.89999******* PP

           GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +g+ i+n+va+eg+er+ r+ +l  Wr+ ++++G+ + +ls++  +qakl+ +k++ ++  ++  + +sl++gWk+ p+ s+SaW+
  29889.m003285 488 HFGEGIKNIVATEGKERKIRNAKLDAWRAFFTRFGMLETELSTSSLCQAKLIAKKFAcGNACTLSMDGKSLLIGWKGTPMHSLSAWK 574
                    *********************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.144182553IPR005202Transcription factor GRAS
PfamPF035141.1E-82209574IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MFNFQEVQDC FSSKNRNPEI VEEANGEPCY GTEDSEESVS NFHQCSDTGF YKDNSSKGSL  60
GFLPQQQEAF LDFGPFDDTR YNILSPPLQT CLKEIEKFGE IKNGIQDHDQ TKKTNQKDQL  120
SSTSLKLLKR YVEGLKRLNS ERIIKPINDT PSMEVPSQEL STEKIVRVAG ERFIQTFTRT  180
VDIVSMLDNP FDLSFSGLSV DEAKKVELAE LLLLSAEKVG NQQYERASIL LNQCDRLSSS  240
TGNAVERVVH YFCKALRERI DRETGKSLGK QHCFNIDEAI MAPSSTILAS YQEVPFSQVA  300
HFAGIQAIVE NVTDAKRIHV IDLGIRVGVQ WTGLMQALVS DFDCNLELLK ITAVGTTSKH  360
LIKDTGKRLT SFAESISLPF AFNIVMVSDM LDLTEDQFEL DSDQTVVVYC EYLLRSLISL  420
PDRLNSVMKV IRILNPSITV VTEPEYNSTS SSFVNRFIEA LFYFSAYFDC LESCMKDNSN  480
RMILESLHFG EGIKNIVATE GKERKIRNAK LDAWRAFFTR FGMLETELST SSLCQAKLIA  540
KKFACGNACT LSMDGKSLLI GWKGTPMHSL SAWKFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-332135748375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006419398.10.0hypothetical protein CICLE_v10004586mg
TrEMBLB9RZP50.0B9RZP5_RICCO; DELLA protein RGL2, putative
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.11e-49RGA-like protein 3